PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.6G244700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 263aa    MW: 29408.1 Da    PI: 7.1389
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.6G244700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.16.4e-161461148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        rg+WT++Ed++l+  +  +G  +W+++++  g+ R++k+c++rw +yl
  Sevir.6G244700.1.p 14 RGPWTADEDKKLISFILTHGRCCWRAVPKLAGLLRCGKSCRLRWTNYL 61
                        89******************************99************97 PP

2Myb_DNA-binding53.65.2e-1770111447
                         S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                          +t E++l +d++++lG++ W++Ia++++ gRt++++k++w+++
  Sevir.6G244700.1.p  70 LSTAEEQLVIDLHAKLGNR-WSKIAAKLP-GRTDNEIKNHWNTH 111
                         5899***************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.0E-20562IPR009057Homeodomain-like
PROSITE profilePS5129412.446961IPR017930Myb domain
SuperFamilySSF466891.16E-2611108IPR009057Homeodomain-like
SMARTSM007171.7E-121363IPR001005SANT/Myb domain
PfamPF002499.1E-151461IPR001005SANT/Myb domain
CDDcd001671.57E-91661No hitNo description
PROSITE profilePS5129427.18162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.3E-2563117IPR009057Homeodomain-like
SMARTSM007177.9E-1566114IPR001005SANT/Myb domain
CDDcd001672.23E-1171112No hitNo description
PfamPF002498.6E-1571111IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
MGRQPCCDKL GVKRGPWTAD EDKKLISFIL THGRCCWRAV PKLAGLLRCG KSCRLRWTNY  60
LRPDLKRGLL STAEEQLVID LHAKLGNRWS KIAAKLPGRT DNEIKNHWNT HIKKKLIKMG  120
IDPATHQPLA NSKMSTSQST DTTKSAKSSD TRDELSVKEG SRRDMALPTD SLEQSSWLES  180
GNNAGRQDQE HLVNWLSETD LPMDEPWLNF TSSDNDVLGI VEGPLPWDGA TDWLLDYQDF  240
GMCSSNLVDN NSTLHSTDGS NF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-27141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004974137.10.0PREDICTED: protein ODORANT1-like
SwissprotQ50EX65e-89ODO1_PETHY; Protein ODORANT1
TrEMBLK3YMD31e-178K3YMD3_SETIT; Uncharacterized protein
STRINGSi015412m1e-178(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G12350.12e-83myb domain protein 42